General Information

  • ID:  hor000680
  • Uniprot ID:  Q766Y6(80-116)
  • Protein name:  Calcitonin receptor-stimulating peptide 3
  • Gene name:  CRSP3
  • Organism:  Sus scrofa (Pig)
  • Family:  Calcitonin family
  • Source:  animal
  • Expression:  Mainly expressed in the thyroid gland and CNS. Found in the nerve cells of cerebrum, hippocampus, hypothalamus, pons/midbrain and thalamus.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Sus (genus), Suidae (family), Suina (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0031716 calcitonin receptor binding
  • GO BP:  GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway; GO:0051480 regulation of cytosolic calcium ion concentration
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  SCNTAICVTHKMAGWLSRSGSVVKNNFMPINMGSKVL
  • Length:  37(80-116)
  • Propeptide:  MGFWKFPPFLILSILVLYQAGMLHAAPFRMALGSSFDSATLTEEEMSLLLVAMVKDYVQMKATVLEQETEDFSITTQERSCNTAICVTHKMAGWLSRSGSVVKNNFMPINMGSKVLGRRRRQPQA
  • Signal peptide:  MGFWKFPPFLILSILVLYQAGMLHA
  • Modification:  T37 Leucine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Causes a rapid but short-lived drop in the level of calcium and phosphate in blood
  • Mechanism:  Promot the incorporation of those ions in the bones.
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  45695
  • Structure ID:  AF-Q766Y6-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000680_AF2.pdbhor000680_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 462503 Formula: C171H282N50O49S5
Absent amino acids: DEQY Common amino acids: S
pI: 10.51 Basic residues: 5
Polar residues: 16 Hydrophobic residues: 12
Hydrophobicity: 21.62 Boman Index: -2773
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 78.92
Instability Index: 5895.14 Extinction Coefficient cystines: 5625
Absorbance 280nm: 156.25

Literature

  • PubMed ID:  12914769
  • Title:  Identification of Second and Third Calcitonin Receptor-Stimulating Peptides in Porcine Brain.
  • PubMed ID:  18544925
  • Title:  Genomic Organization, Expression and Evolution of Porcine CRSP1, 2, and 3